Protein Info for A4249_RS00555 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: excinuclease ABC subunit UvrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 742 TIGR00631: excinuclease ABC subunit B" amino acids 39 to 699 (661 residues), 1009.8 bits, see alignment E=2.4e-308 PF04851: ResIII" amino acids 49 to 154 (106 residues), 46 bits, see alignment E=1.7e-15 PF00270: DEAD" amino acids 56 to 118 (63 residues), 28.1 bits, see alignment E=4.8e-10 PF17757: UvrB_inter" amino acids 195 to 284 (90 residues), 106.7 bits, see alignment E=1.6e-34 PF00271: Helicase_C" amino acids 473 to 584 (112 residues), 67.2 bits, see alignment E=4.4e-22 PF12344: UvrB" amino acids 591 to 632 (42 residues), 76.2 bits, see alignment 4.1e-25 PF02151: UVR" amino acids 669 to 699 (31 residues), 28.1 bits, see alignment (E = 4e-10)

Best Hits

Swiss-Prot: 72% identical to UVRB_ZYMMO: UvrABC system protein B (uvrB) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 87% identity to bsb:Bresu_0952)

MetaCyc: 62% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MYJ0 at UniProt or InterPro

Protein Sequence (742 amino acids)

>A4249_RS00555 excinuclease ABC subunit UvrB (Brevundimonas sp. GW460-12-10-14-LB2)
MPMFAPVAGPRLTPEEPVAAPADWVPHRPSYEGKKKGGRFRLETKYTPAGDQPAAIAELV
AQAQAGDRDQVLLGVTGSGKTFTMAKVIEETQRPALILAPNKTLAAQLYSEFKSFFPDNA
VEYFVSYYDYYQPEAYVPRTDTYIEKDSSINEQIDRMRHSATRAILEREDVIVVASVSCI
YGIGSVETYTAMTFTLKVGDQIDEAKLRADLIALQYKRNDLNFDRGMFRKRGDVIEIFPV
HLEDRAWRISLFGDELEAIQEFDPLTGKKTADLNEITVYAASHYVTPRPTLNQAAAGIKA
ELKETLDWMVENGKLLEAQRLEQRTRFDLEMMEATGSCAGIENYSRWLTGRAPGEPPPTF
FEYIPDNALLFVDESHVTIGQINGMFRGDYRRKSTLAEYGFRLPSCIDNRPLKFEEWEAM
RPQTVHVSATPGPWEMEQAGGVFVEQVIRPTGLIDPPVEIRPVSGKTRNQVDDVIDEVKA
TTAKGYRSLVTTLTKKMAEDLTEYMHEQGIRVRYMHSDVDTLERIEILRDLRLGTFDCLI
GINLLREGLDIPECGLVAILDADKEGFLRSETSLIQTIGRAARNVDGRVILYADRMTGSM
ERAIAETDRRRERQVAYNTEHGITPETVKRDIKEIMDSPYESREMDRLTKPGVAEASKPF
VGSNFQAALRDLEGRMREAASNLEFEEAGRLRDEIKRMKLMDLEFANEALTGAGEAVDKS
APKRWRAEAAAEAQERFRKGRL