Protein Info for A4249_RS00530 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: outer membrane protein transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF03349: Toluene_X" amino acids 22 to 454 (433 residues), 308.5 bits, see alignment E=2.9e-96

Best Hits

Predicted SEED Role

"Long-chain fatty acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MYB4 at UniProt or InterPro

Protein Sequence (454 amino acids)

>A4249_RS00530 outer membrane protein transport protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTSRNFARVGGIALTTALLAGVAAPAMAGSFYVQEQSTRGQGRANAGVGADKGVQSLWWN
PAAIAGTQREVYVGMHGLILDSDVDNRGSTLSYNLPAPTPPFPAGTILSGSTVVAGDPHV
HDVVESGIVPNFAVSMPIGDRFNVGLAVQAPYNFTTKYEQPDFARYDALTSELRSANVSL
VAAMTVTDWLDIGAGFDAQYAKATLSSALPNLPTVAGVAPLVLIPSATDGRNQLEGDGWD
YGWNAGAQMHFGKLDLGLSYRSKIEHELEGSVNISGLTGVLAGANVSTDGGASFTTPWYA
TVSARYAVNDRLTLNAQVNQIGWSEFDAIRVAYTGGGSTIVQDYDDVTTGAIGFDYKIDP
SMTFRAGLGYDPTPTPDDHRTARIPDGDRWLYAAGLSKTIGSMTFDGAVTYIDIDTATIN
DTRDVYGNGLVVSNLRGEAQGSGVGFSLGATWNF