Protein Info for A4249_RS00510 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: DNA repair protein RadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR00608: DNA repair protein RadC" amino acids 28 to 249 (222 residues), 213.7 bits, see alignment E=1.4e-67 PF04002: RadC" amino acids 129 to 248 (120 residues), 150.5 bits, see alignment E=2.1e-48 PF14464: Prok-JAB" amino acids 136 to 220 (85 residues), 26.1 bits, see alignment E=6.7e-10

Best Hits

Swiss-Prot: 54% identical to Y1397_SINFN: UPF0758 protein NGR_c13970 (NGR_c13970) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 54% identity to rhi:NGR_c13970)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MY73 at UniProt or InterPro

Protein Sequence (250 amino acids)

>A4249_RS00510 DNA repair protein RadC (Brevundimonas sp. GW460-12-10-14-LB2)
MSLDEASDGSQHADRTKPIPRHSGHRDRLRERAAKGGLGTLPDYELLELLLFRSVPYKDT
KPLAKDLLARFGGLEGIGAASHEAIEDQVARSMGYAVGKATRAVALDLQLIFDVTRRIAK
EPTAKRPVISSWTALLAYVRVALQHEPREQFRVLYLDKKNQLILDEVQNRGTVDHAPVYP
REVVRRALELSASALILVHNHPSGDPTPSRADIEITKQVVQAGRALNVEVHDHLVVGRDG
VASFKQLGLM