Protein Info for A4249_RS00360 in Brevundimonas sp. GW460-12-10-14-LB2
Annotation: type II toxin-antitoxin system prevent-host-death family antitoxin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 46% identical to Y761_SYNY3: Uncharacterized protein ssr0761 (ssr0761) from Synechocystis sp. (strain PCC 6803 / Kazusa)
KEGG orthology group: None (inferred from 49% identity to mmw:Mmwyl1_0351)MetaCyc: 47% identical to YefM antitoxin of the YoeB-YefM toxin-antitoxin pair and DNA binding transcriptional repressor (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"YefM protein (antitoxin to YoeB)"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A160I1W3 at UniProt or InterPro
Protein Sequence (85 amino acids)
>A4249_RS00360 type II toxin-antitoxin system prevent-host-death family antitoxin (Brevundimonas sp. GW460-12-10-14-LB2) MNAMSVTELRKNLASVIDRVTADHDYTIITREGGKPAAVLMSLEDFASWQETEYLLRSPA NAARLREAISELDAGGGQVRALIEE