Protein Info for A4249_RS00250 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: bifunctional protein-serine/threonine kinase/phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 546 to 564 (19 residues), see Phobius details PF13672: PP2C_2" amino acids 22 to 191 (170 residues), 45.4 bits, see alignment E=1.1e-15 PF07714: PK_Tyr_Ser-Thr" amino acids 272 to 513 (242 residues), 58.3 bits, see alignment E=1.1e-19 PF00069: Pkinase" amino acids 276 to 473 (198 residues), 94.4 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: None (inferred from 69% identity to bsb:Bresu_2148)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MWP7 at UniProt or InterPro

Protein Sequence (566 amino acids)

>A4249_RS00250 bifunctional protein-serine/threonine kinase/phosphatase (Brevundimonas sp. GW460-12-10-14-LB2)
MTDARLEIAAGFATLQGPKADNQDFGGVHIGTAAEQREHGVVAVIADGVSGSKAGRMAAE
LTTRSFIDGYLDQNPLNGIAANGIKALRGFNRWLHSRGRIDPAMEGAATTFTALILRGRE
ATALHVGDSRAWHFRDGVLTRLTEDHTRAQQGLSHVLYRAVGIEADVKLDVRQMRLEPHD
RLLLTTDGVHGVLADAMIAGLLGRRSSPDADAKAILAEVEAAGPRDNATAIVIDVVRTGA
PDWEAITAEAEGLAILAPPAVGDNVDGFALQRLVADGRYTRLFLAKDTLGDAGTVVLKFP
KPAVVSERSARTAFLREAFIGRRIDSPFVGKVLSLDAGRQSRLYIAQPFHAGQTLHARLA
EEGPFEIGEGIGVALRLSRAVSALHRAGVTHRDIKPDNVILETQGGLKLVDLGVARLRLA
EEFAEAEAPGTAGYKAPEMYAGESGDAATDQFALGVTLYRLFTRTYPWGEVDPADAPRFD
RAPAPPTRHRPDMPAWLEAAIMRAVAVDPNERFEDVEELIHVLETGSAVAAPPPRQLSLI
ERDPVRFWQAVSLVLLIAFLVSMATR