Protein Info for A4249_RS00245 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 142 to 168 (27 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details PF01925: TauE" amino acids 13 to 251 (239 residues), 144.9 bits, see alignment E=1.7e-46

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 57% identity to pzu:PHZ_c0735)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MWN7 at UniProt or InterPro

Protein Sequence (260 amino acids)

>A4249_RS00245 sulfite exporter TauE/SafE family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MTTELTPLVLTAFSGGVVALLLTLFGGGGSVLAVPLLLYVVGVADPHVAIGVSAAGVALN
ALTALAGHARAGRVRWPCATLFAITGAAGAWFGSSLAKMIDGHQLLLIFAVAMAAVGVTM
LRPKAAVARDEPRLNWSMSPRVGMAGAGVGSAAGFFGIGGGFLIVPGLMASTGMSLATSQ
ATSLLSVAAFGATTAGNYALSGWVDPGLVAAMAVGGVAGTTAGLPLARRLGSNARLGRIL
FAGLILVVAAYVAVRAILAL