Protein Info for A4249_RS00240 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: rhodanese family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00581: Rhodanese
  • amino acids 8 to 98 (91 residues), 53.4 bits, E=3.1e-18
• PF11127: YgaP-like_TM
  • amino acids 115 to 166 (52 residues), 31.7 bits, E=1.3e-11

Best Hits

Swiss-Prot: 50% identical to YGAP_ECOLI: Inner membrane protein YgaP (ygaP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 59% identity to ccs:CCNA_02956)

MetaCyc: 50% identical to thiosulfate sulfurtransferase YgaP (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]

Predicted SEED Role

"Rhodanese-related sulfurtransferases"

MetaCyc Pathways

• thiosulfate disproportionation IV (rhodanese) (1/1 steps found)
• sulfide oxidation IV (mitochondria) (2/5 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

See A0A161I7D2 at UniProt or InterPro

Protein Sequence (182 amino acids)

>A4249_RS00240 rhodanese family protein (Brevundimonas sp. GW460-12-10-14-LB2)
MSVLTPLSPAEVSHRLKQNAAVLIDIREPDEFAREHVVGAVHAPLSALDAFTPAGIDGRD
VIFTCRTGNRTGVNCDRLAAKTTGQAFVLEGGLDAWKAQGLATHADRSKPIELMRQVQMV
AGGLILIGAALGLLVHPAFWGLSAFVGAGLFFAGATGFCGMARLLAVMPWNKTATRPATR
AA