Protein Info for A4249_RS00215 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: bifunctional diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 PF21815: PdeA_PAS" amino acids 11 to 116 (106 residues), 184 bits, see alignment E=8.1e-59 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 123 to 272 (150 residues), 65.3 bits, see alignment E=2.7e-22 PF00990: GGDEF" amino acids 123 to 270 (148 residues), 78.4 bits, see alignment E=8.4e-26 PF00563: EAL" amino acids 292 to 528 (237 residues), 236.2 bits, see alignment E=5.2e-74

Best Hits

KEGG orthology group: None (inferred from 83% identity to bsb:Bresu_0811)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MWJ3 at UniProt or InterPro

Protein Sequence (555 amino acids)

>A4249_RS00215 bifunctional diguanylate cyclase/phosphodiesterase (Brevundimonas sp. GW460-12-10-14-LB2)
MTPRSRSLAWDATTAIEALAAAETALWVWTPATDELRFTGATRSLGLGPLAPECTAAGFV
ALAMPQDRSLAERMLKPQDEGAEIAVRLRMRGSETCLWRGVWLEDGLRAAGVVALETKFA
GSDRDTLTGLLDRRAFLARVSEVLTQPGEYEIVVGDVDRLRRLNEALGHERTDLVLSALG
SRLAAAFNKDASAARIGEDEFAIIVPKTASHTSYRVRDALEQPLRVAGFDIYPTVSIGAV
MVEGGPDAPDAAELLRRVELAVESAKGAGRGGSAAYGRALESDSLSRLALEADLRNAFVR
GEIVPFFQPIVNLNTGAVAGFEALARWRHPRRGLVPPDEFLGLTADLGMMNDLGLLMMTQ
SARQLAEWIERHPLAGKLFCSVNLSVGEIERPHLCEDVARIIKETGLPKGALKLEVTEGD
IMRDTARAAEVLQSLKDVGASLALDDFGTGFSSLSYLARLPFDTLKIDRYFVLTMNKDEG
SAKIVKSVVNLGRDLSLEVVAEGVENAELARLLLDAQCHYGQGFGYAPALPAQEAEVYLA
ESLADGTAPLKQRSA