Protein Info for A4249_RS00160 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: NADP-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF08240: ADH_N" amino acids 28 to 91 (64 residues), 44.7 bits, see alignment E=1.6e-15 PF00107: ADH_zinc_N" amino acids 156 to 271 (116 residues), 58.8 bits, see alignment E=8.2e-20 PF13602: ADH_zinc_N_2" amino acids 187 to 330 (144 residues), 116.6 bits, see alignment E=2.6e-37

Best Hits

KEGG orthology group: None (inferred from 68% identity to mci:Mesci_2696)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MW93 at UniProt or InterPro

Protein Sequence (334 amino acids)

>A4249_RS00160 NADP-dependent oxidoreductase (Brevundimonas sp. GW460-12-10-14-LB2)
MRAFFLNHYAKKATLRLGEASEPKVGDRDVLVEVHAAGLNLLDSKIRDGAFKPILPYKTP
LVLGHDVAGKVVRVGRAVRRFKVGDEVYSRPRDGRIGTFADYIAITEDDVAPKPRNLSME
EAAGVPLTALTAWQVLVDRADLKPGQKVLIHAGSGGVGILAIQLAKHLGASVATTASAAG
ADLVRSLEADVVVDYKTEDFAQVLSGYDVVLNSLDGETLERSLDVLKPGGKLISISGPPD
PAFARAQGLNWIIRQIIGLGSRKIRAAARARQADYSFVFMRADGAQLSRITALIEAGDIR
PVLDRVFPFEELNAALAYIETGRAKGKVVVSLRP