Protein Info for A4249_RS00155 in Brevundimonas sp. GW460-12-10-14-LB2
Annotation: NAD(P)H-dependent oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to CHRR_PSEPU: Quinone reductase (chrR) from Pseudomonas putida
KEGG orthology group: None (inferred from 66% identity to pzu:PHZ_c1165)MetaCyc: 59% identical to quinone reductase (Pseudomonas putida KT2440)
RXN0-5330 [EC: 1.6.5.9]
Predicted SEED Role
No annotation
MetaCyc Pathways
- aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
- NADH to cytochrome bd oxidase electron transfer II (1/2 steps found)
- NADH to cytochrome bo oxidase electron transfer II (1/2 steps found)
- nitrate reduction VIIIb (dissimilatory) (1/2 steps found)
- mitochondrial NADPH production (yeast) (3/5 steps found)
- superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (5/8 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.6.5.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A168MW88 at UniProt or InterPro
Protein Sequence (184 amino acids)
>A4249_RS00155 NAD(P)H-dependent oxidoreductase (Brevundimonas sp. GW460-12-10-14-LB2) MTVRVALIVGSLRKGSYSRAIGMELKALAEPGLEIEPVEIGDLPLYDPDLETDNPPPAWE RFREEVATTEAVLFVTPEYNRSIPGALKNALDVGSRPYGHSIWQGKPAAIVSVSPGAVAA FGANHHLRQPLVFLNMPTMQQPEAYIGNVADLLDENGKLKKDDTKTFLKSFTDAFAAWID KTKA