Protein Info for A4249_RS00135 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: cytochrome c oxidase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 232 to 261 (30 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details PF00510: COX3" amino acids 10 to 299 (290 residues), 265.5 bits, see alignment E=3.3e-83

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 79% identity to bsb:Bresu_0806)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A168MW64 at UniProt or InterPro

Protein Sequence (302 amino acids)

>A4249_RS00135 cytochrome c oxidase subunit 3 (Brevundimonas sp. GW460-12-10-14-LB2)
MADAHATPQHDYHLVAPSPWPLVSSVAATIMFIGAVIWMKGLAPADGGPIAANFLAEGKP
GVFFAGLAGVLISAFCWWADVIKESKAGDHTPVVSLGLRYGMILFIASEVMFFVAFFWMF
FDMALFHESRALTPEVGTWADTAKAWSTWPPKGVEVLSPWQLPLLNTVTLLLSGCTVTWA
HHAIQVGDRKGAKLALIITVALGVLFTCVQAYEYNHILHEKLFFNEEAVNSGLYGSIFFM
ATGFHGFHVLIGTIFLAVCLIRLLKGDFTPQKHFGFEAAAWYWHFVDVVWLFLFAFVYVV
FG