Protein Info for A4249_RS00115 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: heme o synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01473: protoheme IX farnesyltransferase
  • amino acids 17 to 314 (298 residues), 315 bits, E=3.1e-98
• PF01040: UbiA
  • amino acids 30 to 274 (245 residues), 204 bits, E=1.2e-64

Best Hits

Swiss-Prot: 63% identical to COXX_CAUSK: Protoheme IX farnesyltransferase (ctaB) from Caulobacter sp. (strain K31)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 84% identity to bsb:Bresu_0803)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Methionine metabolism
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

See A0A168MW23 at UniProt or InterPro

Protein Sequence (321 amino acids)

>A4249_RS00115 heme o synthase (Brevundimonas sp. GW460-12-10-14-LB2)
MTEVQTRPVLSTAQPEDFFQLLKPRVMSLVVFTAATGLIVAPGSVNPLVAAIAILCIAVG
AGAAGALNMALEGETDALMRRTRGRPVAAGRVRKNDAMAFGVILSLFSVMLLGMNTNWLA
AGLLAMTIVYYAGFYTLLLKRRTPQNIVIGGAAGAFPPVIGWAAATGHAPWQAWLLFLII
FLWTPPHSWALALYSAGDYAKAGIPMMPVAKGAKSTRLQILLYTLVFVPVAIAPAFAGLG
GIVYLVVSVAGGLGFLGLAVRLYRSRAGDEPDKAEAVGREAALYDVKVQAKPARDLFAFS
ILYLMALFSALLVEALSGLGA