Protein Info for A4249_RS00085 in Brevundimonas sp. GW460-12-10-14-LB2

Annotation: UbiA family prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01040: UbiA
  • amino acids 57 to 322 (266 residues), 173.5 bits, E=2.5e-55

Predicted SEED Role

"4-hydroxybenzoate polyprenyltransferase (EC 2.5.1.39)" (EC 2.5.1.39)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (7/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (3/9 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.39

Sequence Analysis Tools

See A0A168MVW6 at UniProt or InterPro

Protein Sequence (343 amino acids)

>A4249_RS00085 UbiA family prenyltransferase (Brevundimonas sp. GW460-12-10-14-LB2)
MTFAPLPDAGANWVDRHAPEGLKPWLKLGRFDRPIGIWLLLLPGWQGIALALAQYRQAPG
LYDLWLFVGFGIGACLMRAAGCAFNDIVDRDFDARVARTAQRPIPSGRISVKQAWAFVVA
CSLISLLVLLTLPTVAVGLGVGSLALVAAYPFMKRITWWPQAWLGLTFNWGALMGFAAAL
PLAAAALLLPADLAGEFRPFLWSPASESGHAIALTWQAYLPAVLLWIGGVFWTLGYDTIY
ALQDIEDDAMIGVKSSARRLASAVRPGVAVFYGLAVALAVLTGLSANLGPLFWLGLLIYA
AHLARQVVRLDRNDGALALKLFKSNREAGLILLAAIALGSISL