Protein Info for b4586 in Escherichia coli BW25113

Name: ykfM
Annotation: hypothetical protein, no homologs (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 51 to 75 (25 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to YKFM_ECOLI: Uncharacterized protein YkfM (ykfM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4586)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A5A605 at UniProt or InterPro

Protein Sequence (159 amino acids)

>b4586 hypothetical protein, no homologs (RefSeq) (Escherichia coli BW25113)
MRLHVKLKEFLSMFFMAILFFPAFNASLFFTGVKPLYSIIKCSTEIFYDWRMLILCFGFM
SFSFLNIHVILLTIIKSFLIKKTKVVNFATDITIQLTLIFLLIAIVIAPLIAPFVTGYVN
TNYHPCGNNTGIFPGAIYIKNGMKCNNGYISRKEDSAVK