Protein Info for b4256 in Escherichia coli BW25113

Name: yjgM
Annotation: predicted acetyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF13302: Acetyltransf_3" amino acids 11 to 145 (135 residues), 29.3 bits, see alignment E=3.3e-10 PF00583: Acetyltransf_1" amino acids 42 to 144 (103 residues), 71.8 bits, see alignment E=1.5e-23 PF13673: Acetyltransf_10" amino acids 49 to 148 (100 residues), 28.4 bits, see alignment E=3.6e-10 PF13508: Acetyltransf_7" amino acids 59 to 145 (87 residues), 55.8 bits, see alignment E=1.3e-18 PF08445: FR47" amino acids 85 to 148 (64 residues), 22.5 bits, see alignment E=2.3e-08

Best Hits

Swiss-Prot: 100% identical to YJGM_ECOLI: Uncharacterized N-acetyltransferase YjgM (yjgM) from Escherichia coli (strain K12)

KEGG orthology group: K03828, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to eco:b4256)

MetaCyc: 81% identical to O-acetyl-serine N-acetyltransferase, OatA (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-39

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39337 at UniProt or InterPro

Protein Sequence (167 amino acids)

>b4256 predicted acetyltransferase (NCBI) (Escherichia coli BW25113)
MNNIAPQSPVMRRLTLQDNPAIARVIRQVSAEYGLTADKGYTVADPNLDELYQVYSQPGH
AYWVVEYEGEVVGGGGIAPLTGSESDICELQKMYFLPAIRGKGLAKKLALMAMEQAREMG
FKRCYLETTAFLKEAIALYEHLGFEHIDYALGCTGHVDCEVRMLREL