Protein Info for b3833 in Escherichia coli BW25113
Name: ubiE
Annotation: ubiquinone/menaquinone biosynthesis methyltransferase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to UBIE_ECOLC: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 100% identity to eco:b3833)MetaCyc: 100% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]
Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of chorismate metabolism (54/59 steps found)
- superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
- superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
- ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
- superpathway of menaquinol-10 biosynthesis (9/10 steps found)
- superpathway of menaquinol-11 biosynthesis (9/10 steps found)
- superpathway of menaquinol-12 biosynthesis (9/10 steps found)
- superpathway of menaquinol-13 biosynthesis (9/10 steps found)
- superpathway of menaquinol-6 biosynthesis (9/10 steps found)
- superpathway of menaquinol-7 biosynthesis (9/10 steps found)
- superpathway of menaquinol-9 biosynthesis (9/10 steps found)
- menaquinol-10 biosynthesis (2/2 steps found)
- menaquinol-11 biosynthesis (2/2 steps found)
- menaquinol-12 biosynthesis (2/2 steps found)
- menaquinol-13 biosynthesis (2/2 steps found)
- menaquinol-7 biosynthesis (2/2 steps found)
- menaquinol-4 biosynthesis I (1/1 steps found)
- menaquinol-6 biosynthesis (1/1 steps found)
- menaquinol-8 biosynthesis (1/1 steps found)
- menaquinol-9 biosynthesis (1/1 steps found)
- ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
- ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
- ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
- ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
- ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
- superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
- ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
- ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
- superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
- superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0A887 at UniProt or InterPro
Protein Sequence (251 amino acids)
>b3833 ubiquinone/menaquinone biosynthesis methyltransferase (NCBI) (Escherichia coli BW25113) MVDKSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSG VRRGQTVLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYV QANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLS KAYDAYSFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTA GVVALHRGYKF