Protein Info for b3438 in Escherichia coli BW25113

Name: gntR
Annotation: DNA-binding transcriptional repressor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF00356: LacI" amino acids 8 to 52 (45 residues), 65.2 bits, see alignment 7.4e-22 PF00532: Peripla_BP_1" amino acids 64 to 309 (246 residues), 112.6 bits, see alignment E=5.2e-36 PF13407: Peripla_BP_4" amino acids 66 to 274 (209 residues), 45.4 bits, see alignment E=1.6e-15 PF13377: Peripla_BP_3" amino acids 175 to 330 (156 residues), 84.6 bits, see alignment E=1.8e-27

Best Hits

Swiss-Prot: 100% identical to GNTR_ECOL6: HTH-type transcriptional regulator GntR (gntR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 100% identity to eco:b3438)

Predicted SEED Role

"Gluconate utilization system Gnt-I transcriptional repressor" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACP5 at UniProt or InterPro

Protein Sequence (331 amino acids)

>b3438 DNA-binding transcriptional repressor (NCBI) (Escherichia coli BW25113)
MKKKRPVLQDVADRVGVTKMTVSRFLRNPEQVSVALRGKIAAALDELGYIPNRAPDILSN
ATSRAIGVLLPSLTNQVFAEVLRGIESVTDAHGYQTMLAHYGYKPEMEQERLESMLSWNI
DGLILTERTHTPRTLKMIEVAGIPVVELMDSKSPCLDIAVGFDNFEAARQMTTAIIARGH
RHIAYLGARLDERTIIKQKGYEQAMLDAGLVPYSVMVEQSSSYSSGIELIRQARREYPQL
DGVFCTNDDLAVGAAFECQRLGLKVPDDMAIAGFHGHDIGQVMEPRLASVLTPRERMGSI
GAERLLARIRGESVTPKMLDLGFTLSPGGSI