Protein Info for b3367 in Escherichia coli BW25113

Name: nirC
Annotation: nitrite transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 10 to 247 (238 residues), 199.8 bits, see alignment E=2.4e-63 TIGR00790: formate/nitrite transporter" amino acids 21 to 250 (230 residues), 281.2 bits, see alignment E=3.4e-88

Best Hits

Swiss-Prot: 100% identical to NIRC_SHIFL: Nitrite transporter NirC (nirC) from Shigella flexneri

KEGG orthology group: K02598, nitrite transporter NirC (inferred from 100% identity to eco:b3367)

MetaCyc: 100% identical to nitrite transporter NirC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-137

Predicted SEED Role

"Nitrite transporter NirC" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AC26 at UniProt or InterPro

Protein Sequence (268 amino acids)

>b3367 nitrite transporter (NCBI) (Escherichia coli BW25113)
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLV
MGATFGIALTLVIIAGSELFTGHTMFLTFGVKAGSISHGQMWAILPQTWLGNLVGSVFVA
MLYSWGGGSLLPVDTSIVHSVALAKTTAPAMVLFFKGALCNWLVCLAIWMALRTEGAAKF
IAIWWCLLAFIASGYEHSIANMTLFALSWFGNHSEAYTLAGIGHNLLWVTLGNTLSGAVF
MGLGYWYATPKANRPVADKFNQTETAAG