Protein Info for b3210 in Escherichia coli BW25113

Name: arcB
Annotation: hybrid sensory histidine kinase in two-component regulatory system with ArcA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 778 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details PF18415: HKR_ArcB_TM" amino acids 15 to 88 (74 residues), 105.3 bits, see alignment E=8.4e-34 TIGR00229: PAS domain S-box protein" amino acids 152 to 276 (125 residues), 48.9 bits, see alignment E=3.4e-17 PF00989: PAS" amino acids 156 to 266 (111 residues), 64.3 bits, see alignment E=4.1e-21 PF08448: PAS_4" amino acids 161 to 271 (111 residues), 54.4 bits, see alignment E=5.5e-18 PF00512: HisKA" amino acids 283 to 345 (63 residues), 63.8 bits, see alignment 5.1e-21 PF02518: HATPase_c" amino acids 395 to 505 (111 residues), 110 bits, see alignment E=3.5e-35 PF00072: Response_reg" amino acids 528 to 640 (113 residues), 80.1 bits, see alignment E=5.8e-26 PF01627: Hpt" amino acids 686 to 760 (75 residues), 48.2 bits, see alignment E=4.4e-16

Best Hits

Swiss-Prot: 100% identical to ARCB_ECOLI: Aerobic respiration control sensor protein ArcB (arcB) from Escherichia coli (strain K12)

KEGG orthology group: K07648, two-component system, OmpR family, aerobic respiration control sensor histidine kinase ArcB [EC: 2.7.13.3] (inferred from 100% identity to ebw:BWG_2912)

MetaCyc: 100% identical to sensor histidine kinase ArcB (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Aerobic respiration control sensor protein arcB (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AEC3 at UniProt or InterPro

Protein Sequence (778 amino acids)

>b3210 hybrid sensory histidine kinase in two-component regulatory system with ArcA (NCBI) (Escherichia coli BW25113)
MKQIRLLAQYYVDLMMKLGLVRFSMLLALALVVLAIVVQMAVTMVLHGQVESIDVIRSIF
FGLLITPWAVYFLSVVVEQLEESRQRLSRLVQKLEEMRERDLSLNVQLKDNIAQLNQEIA
VREKAEAELQETFGQLKIEIKEREETQIQLEQQSSFLRSFLDASPDLVFYRNEDKEFSGC
NRAMELLTGKSEKQLVHLKPADVYSPEAAAKVIETDEKVFRHNVSLTYEQWLDYPDGRKA
CFEIRKVPYYDRVGKRHGLMGFGRDITERKRYQDALERASRDKTTFISTISHELRTPLNG
IVGLSRILLDTELTAEQEKYLKTIHVSAVTLGNIFNDIIDMDKMERRKVQLDNQPVDFTS
FLADLENLSALQAQQKGLRFNLEPTLPLPHQVITDGTRLRQILWNLISNAVKFTQQGQVT
VRVRYDEGDMLHFEVEDSGIGIPQDELDKIFAMYYQVKDSHGGKPATGTGIGLAVSRRLA
KNMGGDITVTSEQGKGSTFTLTIHAPSVAEEVDDAFDEDDMPLPALNVLLVEDIELNVIV
ARSVLEKLGNSVDVAMTGKAALEMFKPGEYDLVLLDIQLPDMTGLDISRELTKRYPREDL
PPLVALTANVLKDKQEYLNAGMDDVLSKPLSVPALTAMIKKFWDTQDDEESTVTTEENSK
SEALLDIPMLEQYLELVGPKLITDGLAVFEKMMPGYVSVLESNLTAQDKKGIVEEGHKIK
GAAGSVGLRHLQQLGQQIQSPDLPAWEDNVGEWIEEMKEEWRHDVEVLKAWVAKATKK