Protein Info for b2983 in Escherichia coli BW25113

Name: yghQ
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 30 to 58 (29 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 181 to 210 (30 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 313 to 340 (28 residues), see Phobius details PF01943: Polysacc_synt" amino acids 19 to 280 (262 residues), 36.4 bits, see alignment E=4.1e-13 PF13440: Polysacc_synt_3" amino acids 75 to 285 (211 residues), 29.2 bits, see alignment E=5.8e-11

Best Hits

Swiss-Prot: 100% identical to YGHQ_ECOLI: Inner membrane protein YghQ (yghQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2983)

MetaCyc: 100% identical to putative transport protein YghQ (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Inner membrane protein YghQ, probably involved in polysaccharide biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q46841 at UniProt or InterPro

Protein Sequence (355 amino acids)

>b2983 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MAGFNIKHWFADGAFRTIIRNSAWLGSSNVVSALLGLLALSCAGKGMTPAMFGVLVIVQS
YAKSISDFIKFQTWQLVVQYGTPALTNNNPQQFRNVVSFSFSLDIVSGAVAIVGGIALLP
FLSHSLGLDDQSFWLAALYCTLIPSMASSTPTGILRAVDRFDLIAVQQATKPFLRAAGSV
VAWYFDFGFAGFVIAWYVSNLVGGTMYWWFAARELRRRNIHNAFKLNLFESARYIKGAWS
FVWSTNIAHSIWSARNSCSTVLVGIVLGPAAAGLFKIAMTFFDAAGTPAGLLGKSFYPEV
MRLDPRTTRPWLLGVKSGLLAGGIGILVALAVLIVGKPLISLVFGVKYLEAYDLI