Protein Info for b4544 in Escherichia coli BW25113

Name: yfbW
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 1 to 100 (100 residues), 24.6 bits, see alignment E=2.9e-09 PF00892: EamA" amino acids 3 to 107 (105 residues), 40.2 bits, see alignment E=4.2e-14

Best Hits

Swiss-Prot: 100% identical to ARNE_SHIB3: Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE) from Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

KEGG orthology group: K12962, undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnE (inferred from 100% identity to eco:b4544)

MetaCyc: 100% identical to undecaprenyl-phosphate-alpha-L-Ara4N flippase - ArnE subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-276

Predicted SEED Role

"Polymyxin resistance protein PmrL, sucrose-6 phosphate hydrolase" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance )

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q47377 at UniProt or InterPro

Protein Sequence (111 amino acids)

>b4544 hypothetical protein (NCBI) (Escherichia coli BW25113)
MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQN
VPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV