Protein Info for b4412 in Escherichia coli BW25113

Name: hokC
Annotation: toxic membrane protein, small (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01848: HOK_GEF" amino acids 6 to 47 (42 residues), 81.6 bits, see alignment E=1.2e-27

Best Hits

Swiss-Prot: 100% identical to HOKC_ECOLI: Toxic protein HokC (hokC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4412)

Predicted SEED Role

"RelF inactive antibacterial toxin protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACG4 at UniProt or InterPro

Protein Sequence (50 amino acids)

>b4412 toxic membrane protein, small (NCBI) (Escherichia coli BW25113)
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE