Protein Info for b4401 in Escherichia coli BW25113

Name: arcA
Annotation: DNA-binding response regulator in two-component regulatory system with ArcB or CpxA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00072: Response_reg" amino acids 6 to 113 (108 residues), 96.5 bits, see alignment E=1.1e-31 PF00486: Trans_reg_C" amino acids 156 to 232 (77 residues), 67.4 bits, see alignment E=9.4e-23

Best Hits

Swiss-Prot: 100% identical to ARCA_ECOL6: Aerobic respiration control protein ArcA (arcA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07773, two-component system, OmpR family, aerobic respiration control protein ArcA (inferred from 100% identity to eco:b4401)

Predicted SEED Role

"Aerobic respiration control protein arcA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9Q1 at UniProt or InterPro

Protein Sequence (238 amino acids)

>b4401 DNA-binding response regulator in two-component regulatory system with ArcB or CpxA (NCBI) (Escherichia coli BW25113)
MQTPHILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEYDINLVIMDINLPGK
NGLLLARELREQANVALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSR
TMNLGTVSEERRSVESYKFNGWELDINSRSLIGPDGEQYKLPRSEFRAMLHFCENPGKIQ
SRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTPDTPEIIATIHGEGYRFCGDLED