Protein Info for b4389 in Escherichia coli BW25113

Name: radA
Annotation: predicted repair protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 TIGR00416: DNA repair protein RadA" amino acids 1 to 454 (454 residues), 796.9 bits, see alignment E=2.7e-244 PF18073: Zn_ribbon_LapB" amino acids 9 to 36 (28 residues), 41.3 bits, see alignment (E = 3.8e-14) PF23442: DUF7125" amino acids 76 to 189 (114 residues), 31.4 bits, see alignment E=5.4e-11 PF06745: ATPase" amino acids 78 to 151 (74 residues), 43.2 bits, see alignment E=1.3e-14 PF13481: AAA_25" amino acids 88 to 225 (138 residues), 55.5 bits, see alignment E=2.4e-18 PF13541: ChlI" amino acids 348 to 433 (86 residues), 37 bits, see alignment E=1.2e-12 PF05362: Lon_C" amino acids 356 to 454 (99 residues), 31 bits, see alignment E=7.6e-11

Best Hits

Swiss-Prot: 100% identical to RADA_ECOLI: DNA repair protein RadA (radA) from Escherichia coli (strain K12)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 100% identity to eco:b4389)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P24554 at UniProt or InterPro

Protein Sequence (460 amino acids)

>b4389 predicted repair protein (NCBI) (Escherichia coli BW25113)
MAKAPKRAFVCNECGADYPRWQGQCSACHAWNTITEVRLAASPMVARNERLSGYAGSAGV
AKVQKLSDISLEELPRFSTGFKEFDRVLGGGVVPGSAILIGGNPGAGKSTLLLQTLCKLA
QQMKTLYVTGEESLQQVAMRAHRLGLPTDNLNMLSETSIEQICLIAEEEQPKLMVIDSIQ
VMHMADVQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHVTKDGSLAGPKVLEHCIDCS
VLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREVSNPSAIFLSRGDEVTSGSSV
MVVWEGTRPLLVEIQALVDHSMMANPRRVAVGLEQNRLAILLAVLHRHGGLQMADQDVFV
NVVGGVKVTETSADLALLLAMVSSLRDRPLPQDLVVFGEVGLAGEIRPVPSGQERISEAA
KHGFRRAIVPAANVPKKAPEGMQIFGVKKLSDALSVFDDL