Protein Info for b4387 in Escherichia coli BW25113
Name: ytjB
Annotation: hypothetical protein (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to SMP_ECOLI: Probable inner membrane protein Smp (ytjB) from Escherichia coli (strain K12)
KEGG orthology group: K07186, membrane protein (inferred from 100% identity to eco:b4387)Predicted SEED Role
"Lipoate-protein ligase A" in subsystem Lipoic acid metabolism
MetaCyc Pathways
- lipoate salvage I (1/2 steps found)
- lipoate salvage II (1/4 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0AGC7 at UniProt or InterPro
Protein Sequence (214 amino acids)
>b4387 hypothetical protein (NCBI) (Escherichia coli BW25113) MARTKLKFRLHRAVIVLFCLALLVALMQGASWFSQNHQRQRNPQLEELARTLARQVTLNV APLMRTDSPDEKRIQAILDQLTDESRILDAGVYDEQGDLIARSGESVEVRDRLALDGKKA GGYFNQQIVEPIAGKNGPLGYLRLTLDTHTLATEAQQVDNTTNILRLMLLLSLAIGVVLT RTLLQGKRTRWQQSPFLLTASKPVPEEEESEKKE