Protein Info for b4363 in Escherichia coli BW25113

Name: yjjB
Annotation: conserved inner membrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 126 to 151 (26 residues), see Phobius details PF12821: ThrE_2" amino acids 13 to 146 (134 residues), 114.7 bits, see alignment E=1.8e-37

Best Hits

Swiss-Prot: 100% identical to YJJB_ECOLI: UPF0442 protein YjjB (yjjB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4363)

Predicted SEED Role

"FIG001826: putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ADD2 at UniProt or InterPro

Protein Sequence (157 amino acids)

>b4363 conserved inner membrane protein (RefSeq) (Escherichia coli BW25113)
MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIE
WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV