Protein Info for b4346 in Escherichia coli BW25113

Name: mcrB
Annotation: component of McrBC 5-methylcytosine restriction system (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF12102: MrcB_N" amino acids 20 to 101 (82 residues), 28 bits, see alignment E=4.1e-10 PF01078: Mg_chelatase" amino acids 195 to 232 (38 residues), 20.5 bits, see alignment 6.9e-08 PF07728: AAA_5" amino acids 196 to 350 (155 residues), 111 bits, see alignment E=1.2e-35 PF00004: AAA" amino acids 197 to 351 (155 residues), 26.7 bits, see alignment E=1.7e-09 PF28529: McrB_lid" amino acids 381 to 447 (67 residues), 71.7 bits, see alignment E=1e-23

Best Hits

Swiss-Prot: 100% identical to MCRB_ECOLI: 5-methylcytosine-specific restriction enzyme B (mcrB) from Escherichia coli (strain K12)

KEGG orthology group: K07452, 5-methylcytosine-specific restriction enzyme B [EC: 3.1.21.-] (inferred from 100% identity to eco:b4346)

MetaCyc: 100% identical to Type IV methyl-directed restriction enzyme EcoKMcrB subunit (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"enzyme; Degradation of DNA"

Isozymes

Compare fitness of predicted isozymes for: 3.1.21.-

Use Curated BLAST to search for 3.1.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P15005 at UniProt or InterPro

Protein Sequence (459 amino acids)

>b4346 component of McrBC 5-methylcytosine restriction system (VIMSS) (Escherichia coli BW25113)
MESIQPWIEKFIKQAQQQRSQSTKDYPTSYRNLRVKLSFGYGNFTSIPWFAFLGEGQEAS
NGIYPVILYYKDFDELVLAYGISDTNEPHAQWQFSSDIPKTIAEYFQATSGVYPKKYGQS
YYACSQKVSQGIDYTRFASMLDNIINDYKLIFNSGKSVIPPMSKTESYCLEDALNDLFIP
ETTIETILKRLTIKKNIILQGPPGVGKTFVARRLAYLLTGEKAPQRVNMVQFHQSYSYED
FIQGYRPNGVGFRRKDGIFYNFCQQAKEQPEKKYIFIIDEINRANLSKVFGEVMMLMEHD
KRGENWSVPLTYSENDEERFYVPENVYIIGLMNTADRSLAVVDYALRRRFSFIDIEPGFD
TPQFRNFLLNKKAEPSFVESLCQKMNELNQEISKEATILGKGFRIGHSYFCCGLEDGTSP
DTQWLNEIVMTDIAPLLEEYFFDDPYKQQKWTNKLLGDS