Protein Info for b4336 in Escherichia coli BW25113

Name: yjiN
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 398 to 420 (23 residues), see Phobius details PF04286: DUF445" amino acids 44 to 417 (374 residues), 406 bits, see alignment E=1.4e-125

Best Hits

Swiss-Prot: 100% identical to YJIN_ECOLI: Uncharacterized protein YjiN (yjiN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4336)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39385 at UniProt or InterPro

Protein Sequence (426 amino acids)

>b4336 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MNKLIELRRAKRLALSLLLIAAATFVVTLFLPPNFWVSGVKAIAEAAMVGALADWFAVVA
LFRRVPIPIISRHTAIIPRNKDRIGENLGQFVQEKFLDTQSLVALIRRHEPALLIGNWFS
QPENARRVGQHLLQIMSGFLELTDDARIQRLLKRAVHRAIDKVDLSGTSALMLESMTKND
RHQVLLDTLIAQLIALLQRDKSRKFIAQQIVRWLESEHPLKAKILPTEWLGEHSAELVSD
AVNSLLDDISRDRAHQIRHAFDRATFALIDKLKNDPEMAARADAVKSYLKEDEAFNRYLS
ELWGDLREWLKVDINSEDSRVKERIARAGQWFGETLIADDALRASLNGHLEQAAHRVAPE
FSAFLTRHISDTVKSWDARDMSRQIELNIGKDLQFIRVNGTLVGGCIGLILYLLSQLPAL
FPLGNF