Protein Info for b4333 in Escherichia coli BW25113

Name: yjiK
Annotation: conserved protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details amino acids 29 to 30 (2 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details PF06977: SdiA-regulated" amino acids 37 to 281 (245 residues), 317 bits, see alignment E=7.4e-99

Best Hits

Swiss-Prot: 100% identical to YJIK_ECOLI: Uncharacterized protein YjiK (yjiK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4333)

Predicted SEED Role

"FIG00637952: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39382 at UniProt or InterPro

Protein Sequence (286 amino acids)

>b4333 conserved protein (RefSeq) (Escherichia coli BW25113)
MTKSISLSKRISIIVILFAIVAVCTFFVQSCARKSNHAASFQNYHATIDGKEIAGITNNI
SSLTWSAQSNTLFSTINKPAAIVEMTTNGDFIRTIPLDFVKDLETIEYIGDNQFVISDER
DYAIYVISLTPNSEVKILKKIKIPLQDSPTNCGFEGLAYSRQDHTFWFFKEKNPIEVYKV
NGLLSSNELHISKDEALQRQFTLDDVSGAEFNQQKNTLLVLSHESRALQEVTLVGEVIGE
MSLTKGSRGLSHNIKQAEGVAMDASGNIYIVSEPNRFYRFTPQSSH