Protein Info for b4332 in Escherichia coli BW25113

Name: yjiJ
Annotation: predicted inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 211 to 235 (25 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 361 to 384 (24 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 349 (329 residues), 66.4 bits, see alignment E=2.3e-22 PF06779: MFS_4" amino acids 23 to 380 (358 residues), 478.2 bits, see alignment E=2.2e-147

Best Hits

Swiss-Prot: 100% identical to YJIJ_ECOLI: Uncharacterized protein YjiJ (yjiJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4332)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39381 at UniProt or InterPro

Protein Sequence (392 amino acids)

>b4332 predicted inner membrane protein (NCBI) (Escherichia coli BW25113)
MPSSTHPVERFSFSTALFGMLVLTLGMGLGRFLYTPMLPVMMAEGSFSFSQLSWIASGNY
AGYLAGSLLFSFGAFHQPSRLRPFLLASALASGLLILAMAWLPPFILVLLIRVLAGVASA
GMLIFGSTLIMQHTRHPFVLAALFSGVGIGIALGNEYVLAGLHFDLSSQTLWQGAGALSG
MMLIALTLLMPSKKHAITPMPLAKTEQQIMSWWLLAILYGLAGFGYIIVATYLPLMAKDA
GSPLLTAHLWTLVGLSIVPGCFGWLWAAKRWGALPCLTANLLVQAICVLLTLASDSPLLL
IISSLGFGGTFMGTTSLVMTIARQLSVPGNLNLLGFVTLIYGIGQILGPALTSMLSNGTS
ALASATLCGAAALFIAALISTVQLFKLQVVTS