Protein Info for b4295 in Escherichia coli BW25113

Name: yjhU
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF04198: Sugar-bind" amino acids 64 to 323 (260 residues), 267.7 bits, see alignment E=4.5e-84

Best Hits

Swiss-Prot: 100% identical to YJHU_ECOLI: Uncharacterized transcriptional regulator YjhU (yjhU) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4295)

Predicted SEED Role

"Erythritol transcriptional regulator EryD" in subsystem Erythritol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39356 at UniProt or InterPro

Protein Sequence (328 amino acids)

>b4295 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MDRDQTNSSLFNDDPVLHATWLYYQEGKSQTEVAAIMGVSRVTVVKYLQTARENGLVHIN
LDVNVFGSIDAALQIRDKFNLQRVIIVPDGEHAGKRDDTKLMRTRLSRAGGMYLNQVIEN
GDVLGVAWGRTIHQMSKTMTPKSCKNVTVIQMLGSMPSQPDLTIIESSSQIAYKLSGRVA
SLHVPAVVSSARLAMELQAEPIIRSNFDVLTRCTKAFFVVGNALDENPLIRVGVLNKKEM
QTYRDLGAVGVICGRFYDKEGMPVVADVDQRILGISLAQLRQIERKIFLAGGERGYDATL
GALLGGYVTDLIVDEGTAEFLLACELPH