Protein Info for b4292 in Escherichia coli BW25113

Name: fecR
Annotation: KpLE2 phage-like element; transmembrane signal transducer for ferric citrate transport (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 82 to 99 (18 residues), see Phobius details PF16220: DUF4880" amino acids 15 to 56 (42 residues), 38.6 bits, see alignment 7.7e-14 PF04773: FecR" amino acids 110 to 202 (93 residues), 59 bits, see alignment E=5.5e-20

Best Hits

Swiss-Prot: 100% identical to FECR_ECOLI: Protein FecR (fecR) from Escherichia coli (strain K12)

KEGG orthology group: K07165, transmembrane sensor (inferred from 100% identity to eco:b4292)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P23485 at UniProt or InterPro

Protein Sequence (317 amino acids)

>b4292 KpLE2 phage-like element; transmembrane signal transducer for ferric citrate transport (NCBI) (Escherichia coli BW25113)
MNPLLTDSRRQALRSASHWYAVLSGERVSPQQEARWQQWYEQDQDNQWAWQQVENLRNQL
GGVPGDVASRALHDTRLTRRHVMKGLLLLLGAGGGWQLWQSETGEGLRADYRTAKGTVSR
QQLEDGSLLTLNTQSAADVRFDAHQRTVRLWYGEIAITTAKDALQRPFRVLTRQGQLTAL
GTEFTVRQQDNFTQLDVQQHAVEVLLASAPAQKRIVNAGESLQFSASEFGAVKPLDDEST
SWTKDILSFSDKPLGEVIATLTRYRNGVLRCDPAVAGLRLSGTFPLKNTDAILNVIAQTL
PVKIQSITRYWINISPL