Protein Info for b4280 in Escherichia coli BW25113

Name: yjhC
Annotation: putative dehydrogenase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF01408: GFO_IDH_MocA" amino acids 2 to 118 (117 residues), 114.6 bits, see alignment E=4.5e-37 PF02894: GFO_IDH_MocA_C" amino acids 130 to 362 (233 residues), 193.7 bits, see alignment E=3.8e-61

Best Hits

Swiss-Prot: 100% identical to YJHC_ECOLI: Uncharacterized oxidoreductase YjhC (yjhC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4280)

MetaCyc: 100% identical to KpLE2 phage-like element; 2,7-anhydro-N-acetylneuraminate hydratase (Escherichia coli K-12 substr. MG1655)
4.2.1.-; 4.2.1.-

Predicted SEED Role

"FIG00553873: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39353 at UniProt or InterPro

Protein Sequence (372 amino acids)

>b4280 putative dehydrogenase (VIMSS) (Escherichia coli BW25113)
MINYGVVGVGYFGAELARFMNMHDNAKITCVYDPENGENIARELQCINMSSLDALVSSKL
VDCVIVATPNYLHKEPVIKAAKNKKHVFCEKPIALSYEDCVDMVKACKEAGVTFMAGHIM
NFFNGVQYARKLIKEGVIGEILSCHTKRNGWENKQERLSWKKMKEQSGGHLYHHIHELDC
VQHLLGEIPETVTMIGGNLAHSGPGFGNEDDMLFMTLEFPSGKLATLEWGSAFNWPEHYV
IINGTKGSIKIDMQETAGSLRIGGQTKHFLVHETQEEDDDRRKGNMTSEMDGAIAYGHPG
KKTPLWLASLIRKETLFLHNILCGAKPEEDYIDLLNGEAAMSAIATADAATLSRSQDRKV
KISEIIKHTSVM