Protein Info for b4279 in Escherichia coli BW25113

Name: yjhB
Annotation: putative transport protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details amino acids 166 to 185 (20 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 242 (222 residues), 120.9 bits, see alignment E=6e-39 amino acids 221 to 390 (170 residues), 59.4 bits, see alignment E=3.1e-20 PF00083: Sugar_tr" amino acids 49 to 200 (152 residues), 84.1 bits, see alignment E=1e-27

Best Hits

Swiss-Prot: 100% identical to YJHB_ECOLI: Putative metabolite transport protein YjhB (yjhB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4279)

MetaCyc: 100% identical to sialic acid transporter NanX (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-415

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39352 at UniProt or InterPro

Protein Sequence (405 amino acids)

>b4279 putative transport protein (VIMSS) (Escherichia coli BW25113)
MATAWYKQVNPPQRKALFSAWLGYVFDGFDFMMIFYILHIIKADLGITDIQATLIGTVAF
IARPIGGGFFGAMADKYGRKPMMMWAIFIYSVGTGLSGIATNLYMLAVCRFIVGLGMSGE
YACASTYAVESWPKNLQSKASAFLVSGFSVGNIIAAQIIPQFAEVYGWRNSFFIGLLPVL
LVLWIRKSAPESQEWIEDKYKDKSTFLSVFRKPHLSISMIVFLVCFCLFGANWPINGLLP
SYLADNGVNTVVISTLMTIAGLGTLTGTIFFGFVGDKIGVKKAFVVGLITSFIFLCPLFF
ISVKNSSLIGLCLFGLMFTNLGIAGLVPKFIYDYFPTKLRGLGTGLIYNLGATGGMAAPV
LATYISGYYGLGVSLFIVTVAFSALLILLVGFDIPGKIYKLSVAK