Protein Info for b4264 in Escherichia coli BW25113

Name: idnR
Annotation: DNA-binding transcriptional repressor, 5-gluconate-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF00356: LacI" amino acids 7 to 52 (46 residues), 72.8 bits, see alignment 3e-24 PF00532: Peripla_BP_1" amino acids 65 to 318 (254 residues), 76.7 bits, see alignment E=4.5e-25 PF13407: Peripla_BP_4" amino acids 67 to 312 (246 residues), 57.3 bits, see alignment E=3.6e-19 PF13377: Peripla_BP_3" amino acids 177 to 327 (151 residues), 75.5 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 100% identical to IDNR_ECOLI: HTH-type transcriptional regulator IdnR (idnR) from Escherichia coli (strain K12)

KEGG orthology group: K06146, LacI family transcriptional regulator, gluconate utilization system Gnt-II transcriptional activator (inferred from 100% identity to eco:b4264)

Predicted SEED Role

"Positive regulator of L-idonate catabolism" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39343 at UniProt or InterPro

Protein Sequence (332 amino acids)

>b4264 DNA-binding transcriptional repressor, 5-gluconate-binding (NCBI) (Escherichia coli BW25113)
MRNHRISLQDIATLAGVTKMTVSRYIRSPKKVAKETGERIAKIMEEINYIPNRAPGMLLN
AQSYTLGILIPSFQNQLFADILAGIESVTSEHNYQTLIANYNYDRDSEEESVINLLSYNI
DGIILSEKYHTIRTVKFLRSATIPVVELMDVQGERLDMEVGFDNRQAAFDMVCTMLEKRV
RHKILYLGSKDDTRDEQRYQGYCDAMMLHNLSPLRMNPRAISSIHLGMQLMRDALSANPD
LDGVFCTNDDIAMGALLLCRERNLAVPEQISIAGFHGLEIGRQMIPSLASVITPRFDIGR
MAAQMLLSKIKNNDHNHNTVDLGYQIYHGNTL