Protein Info for b4261 in Escherichia coli BW25113

Name: yjgP
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 2 to 348 (347 residues), 385 bits, see alignment E=1.2e-119 PF03739: LptF_LptG" amino acids 5 to 345 (341 residues), 257.9 bits, see alignment E=7.8e-81

Best Hits

Swiss-Prot: 100% identical to LPTF_ECOLI: Lipopolysaccharide export system permease protein LptF (lptF) from Escherichia coli (strain K12)

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 100% identity to eco:b4261)

MetaCyc: 100% identical to lipopolysaccharide transport system protein LptF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"FIG000988: Predicted permease"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AF98 at UniProt or InterPro

Protein Sequence (366 amino acids)

>b4261 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPANLVLSLLGLGVPEMA
QLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMILAVFTAIVAAVNVMWA
GPWSSRHQDEVLAEAKANPGMAALAQGQFQQATNGSSVLFIESVDGSDFKDVFLAQIRPK
GNARPSVVVADSGHLTQLRDGSQVVTLNQGTRFEGTALLRDFRITDFQDYQAIIGHQAVA
LDPNDTDQMDMRTLWNTDTDRARAELNWRITLVFTVFMMALMVVPLSVVNPRQGRVLSML
PAMLLYLLFFLIQTSLKSNGGKGKLDPTLWMWTVNLIYLALAIVLNLWDTVPVRRLRASF
SRKGAV