Protein Info for b4230 in Escherichia coli BW25113

Name: ytfT
Annotation: predicted sugar transporter subunit: membrane component of ABC superfamily (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 signal peptide" amino acids 21 to 21 (1 residues), see Phobius details transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 57 to 321 (265 residues), 179.4 bits, see alignment E=4e-57

Best Hits

Swiss-Prot: 100% identical to YTFT_ECOLI: Inner membrane ABC transporter permease protein YtfT (ytfT) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to eco:b4230)

MetaCyc: 100% identical to galactofuranose ABC transporter putative membrane subunit YtfT (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, permease protein YtfT"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39328 at UniProt or InterPro

Protein Sequence (341 amino acids)

>b4230 predicted sugar transporter subunit: membrane component of ABC superfamily (RefSeq) (Escherichia coli BW25113)
MMPQSLPDTTTPKRRFRWPTGMPQLVALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDIL
NRAAPVALLAIGMTLVIATGGIDLSVGAVMAIAGATTAAMTVAGFSLPIVLLSALGTGIL
AGLWNGILVAILKIQPFVATLILMVAGRGVAQLITAGQIVTFNSPDLSWFGSGSLLFLPT
PVIIAVLTLILFWLLTRKTALGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIA
GIIVAADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGIL
LSGFPPEMNQVVKAVVVLCVLIVQSQRFISLIKGVRSRDKT