Protein Info for b4222 in Escherichia coli BW25113

Name: ytfP
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF06094: GGACT" amino acids 3 to 109 (107 residues), 100.4 bits, see alignment E=5.3e-33

Best Hits

Swiss-Prot: 100% identical to YTFP_SHIFL: Gamma-glutamylcyclotransferase family protein YtfP (ytfP) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b4222)

Predicted SEED Role

"UPF0131 protein YtfP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AE48 at UniProt or InterPro

Protein Sequence (113 amino acids)

>b4222 hypothetical protein (NCBI) (Escherichia coli BW25113)
MRIFVYGSLRHKQGNSHWMTNAQLLGDFSIDNYQLYSLGHYPGAVPGNGTVHGEVYRIDN
ATLAELDALRTRGGEYARQLIQTPYGSAWMYVYQRPVDGLKLIESGDWLDRDK