Protein Info for b4210 in Escherichia coli BW25113

Name: ytfF
Annotation: predicted inner membrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 5 to 25 (21 residues), see Phobius details amino acids 35 to 52 (18 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details PF00892: EamA" amino acids 3 to 135 (133 residues), 52.1 bits, see alignment E=4.5e-18

Best Hits

Swiss-Prot: 100% identical to YTFF_ECOLI: Inner membrane protein YtfF (ytfF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b4210)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39314 at UniProt or InterPro

Protein Sequence (321 amino acids)

>b4210 predicted inner membrane protein (RefSeq) (Escherichia coli BW25113)
MISGVLYALLAGLMWGLIFVGPLIVPEYPAMLQSMGRYLALGLIALPIAWLGRVRLRQLA
RRDWLTALMLTMMGNLIYYFCLASAIQRTGAPVSTMIIGTLPVVIPVFANLLYSQRDGKL
AWGKLAPALICIGIGLACVNIAELNHGLPDFDWARYTSGIVLALVSVVCWAWYALRNARW
LRENPDKHPMMWATAQALVTLPVSLIGYLVACYWLNTQTPDFSLPFGPRPLVFISLMVAI
AVLCSWVGALCWNVASQLLPTVILGPLIVFETLAGLLYTFLLRQQMPPLMTLSGIALLVI
GVVIAVRAKPEKPLTESVSES