Protein Info for b4197 in Escherichia coli BW25113

Name: ulaE
Annotation: L-xylulose 5-phosphate 3-epimerase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00542: putative hexulose-6-phosphate isomerase" amino acids 4 to 281 (278 residues), 515 bits, see alignment E=2.4e-159 PF01261: AP_endonuc_2" amino acids 25 to 273 (249 residues), 191.3 bits, see alignment E=1.2e-60

Best Hits

Swiss-Prot: 100% identical to ULAE_ECOBW: L-ribulose-5-phosphate 3-epimerase UlaE (ulaE) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K03079, L-ribulose-5-phosphate 3-epimerase [EC: 5.1.3.22] (inferred from 100% identity to eco:b4197)

MetaCyc: 100% identical to L-ribulose-5-phosphate 3-epimerase UlaE (Escherichia coli K-12 substr. MG1655)
L-ribulose-5-phosphate 3-epimerase. [EC: 5.1.3.22]

Predicted SEED Role

"L-ribulose-5-phosphate 3-epimerase UlaE (EC 5.1.3.22) (L-ascorbate utilization protein E)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 5.1.3.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39305 at UniProt or InterPro

Protein Sequence (284 amino acids)

>b4197 L-xylulose 5-phosphate 3-epimerase (NCBI) (Escherichia coli BW25113)
MLSKQIPLGIYEKALPAGECWLERLQLAKTLGFDFVEMSVDETDDRLSRLNWSREQRLAL
VNAIVETGVRVPSMCLSAHRRFPLGSEDDAVRAQGLEIMRKAIQFAQDVGIRVIQLAGYD
VYYQEANNETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMSSISKALGYAHYLNNPWF
QLYPDIGNLSAWDNDVQMELQAGIGHIVAVHVKDTKPGVFKNVPFGEGVVDFERCFETLK
QSGYCGPYLIEMWSETAEDPAAEVAKARDWVKARMAKAGMVEAA