Protein Info for b4194 in Escherichia coli BW25113

Name: ulaB
Annotation: L-ascorbate-specific enzyme IIB component of PTS (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF02302: PTS_IIB" amino acids 4 to 80 (77 residues), 53.2 bits, see alignment E=2e-18

Best Hits

Swiss-Prot: 100% identical to ULAB_ECO57: Ascorbate-specific PTS system EIIB component (ulaB) from Escherichia coli O157:H7

KEGG orthology group: K02822, PTS system, ascorbate-specific IIB component [EC: 2.7.1.69] (inferred from 100% identity to eco:b4194)

MetaCyc: 100% identical to L-ascorbate specific PTS enzyme IIB component (Escherichia coli K-12 substr. MG1655)
RXN0-2461 [EC: 2.7.1.194]

Predicted SEED Role

"Ascorbate-specific PTS system, EIIB component (EC 2.7.1.69)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.194 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P69822 at UniProt or InterPro

Protein Sequence (101 amino acids)

>b4194 L-ascorbate-specific enzyme IIB component of PTS (NCBI) (Escherichia coli BW25113)
MTVRILAVCGNGQGSSMIMKMKVDQFLTQSNIDHTVNSCAVGEYKSELSGADIIIASTHI
AGEITVTGNKYVVGVRNMLSPADFGPKLLEVIKEHFPQDVK