Protein Info for b4193 in Escherichia coli BW25113

Name: sgaT
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 141 to 171 (31 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 305 to 364 (60 residues), see Phobius details amino acids 379 to 403 (25 residues), see Phobius details amino acids 422 to 445 (24 residues), see Phobius details PF03611: EIIC-GAT" amino acids 15 to 406 (392 residues), 366.7 bits, see alignment E=8.4e-114

Best Hits

Swiss-Prot: 100% identical to ULAA_ECOLI: Ascorbate-specific PTS system EIIC component (ulaA) from Escherichia coli (strain K12)

KEGG orthology group: K03475, PTS system, ascorbate-specific IIC component (inferred from 100% identity to eco:b4193)

MetaCyc: 100% identical to L-ascorbate specific PTS enzyme IIC component (Escherichia coli K-12 substr. MG1655)
RXN0-2461 [EC: 2.7.1.194]

Predicted SEED Role

"Ascorbate-specific PTS system, EIIC component" in subsystem L-ascorbate utilization (and related gene clusters)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.194

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39301 at UniProt or InterPro

Protein Sequence (465 amino acids)

>b4193 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MEILYNIFTVFFNQVMTNAPLLLGIVTCLGYILLRKSVSVIIKGTIKTIIGFMLLQAGSG
ILTSTFKPVVAKMSEVYGINGAISDTYASMMATIDRMGDAYSWVGYAVLLALALNICYVL
LRRITGIRTIMLTGHIMFQQAGLIAVTLFIFGYSMWTTIICTAILVSLYWGITSNMMYKP
TQEVTDGCGFSIGHQQQFASWIAYKVAPFLGKKEESVEDLKLPGWLNIFHDNIVSTAIVM
TIFFGAILLSFGIDTVQAMAGKVHWTVYILQTGFSFAVAIFIITQGVRMFVAELSEAFNG
ISQRLIPGAVLAIDCAAIYSFAPNAVVWGFMWGTIGQLIAVGILVACGSSILIIPGFIPM
FFSNATIGVFANHFGGWRAALKICLVMGMIEIFGCVWAVKLTGMSAWMGMADWSILAPPM
MQGFFSIGIAFMAVIIVIALAYMFFAGRALRAEEDAEKQLAEQSA