Protein Info for b4191 in Escherichia coli BW25113
Name: ulaR
Annotation: DNA-binding transcriptional dual regulator (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to ULAR_ECO5E: HTH-type transcriptional regulator UlaR (ulaR) from Escherichia coli O157:H7 (strain EC4115 / EHEC)
KEGG orthology group: K03477, DeoR family transcriptional regulator, ulaG and ulaABCDEF operon transcriptional repressor (inferred from 100% identity to eco:b4191)Predicted SEED Role
"Ascorbate utilization transcriptional regulator UlaR, HTH-type" in subsystem L-ascorbate utilization (and related gene clusters)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0A9W0 at UniProt or InterPro
Protein Sequence (251 amino acids)
>b4191 DNA-binding transcriptional dual regulator (NCBI) (Escherichia coli BW25113) MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAIT QQRPRWTPMNLHQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQII TNYLPLANYLIDQEHDSVIIMGGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGLTAEGL YKTDMLTAMAEQKMLSVVGKLVVLVDSSKIGERAGMLFSRADQIDMLITGKNANPEILQQ LEAQGVSILRV