Protein Info for b4191 in Escherichia coli BW25113

Name: ulaR
Annotation: DNA-binding transcriptional dual regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF08220: HTH_DeoR" amino acids 6 to 62 (57 residues), 72.8 bits, see alignment E=2.3e-24 PF00455: DeoRC" amino acids 76 to 230 (155 residues), 132.5 bits, see alignment E=2.1e-42

Best Hits

Swiss-Prot: 100% identical to ULAR_ECO5E: HTH-type transcriptional regulator UlaR (ulaR) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03477, DeoR family transcriptional regulator, ulaG and ulaABCDEF operon transcriptional repressor (inferred from 100% identity to eco:b4191)

Predicted SEED Role

"Ascorbate utilization transcriptional regulator UlaR, HTH-type" in subsystem L-ascorbate utilization (and related gene clusters)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9W0 at UniProt or InterPro

Protein Sequence (251 amino acids)

>b4191 DNA-binding transcriptional dual regulator (NCBI) (Escherichia coli BW25113)
MTEAQRHQILLEMLAQLGFVTVEKVVERLGISPATARRDINKLDESGKLKKVRNGAEAIT
QQRPRWTPMNLHQAQNHDEKVRIAKAASQLVNPGESVVINCGSTAFLLGREMCGKPVQII
TNYLPLANYLIDQEHDSVIIMGGQYNKSQSITLSPQGSENSLYAGHWMFTSGKGLTAEGL
YKTDMLTAMAEQKMLSVVGKLVVLVDSSKIGERAGMLFSRADQIDMLITGKNANPEILQQ
LEAQGVSILRV