Protein Info for b4176 in Escherichia coli BW25113

Name: yjeT
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 65 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details PF09838: DUF2065" amino acids 5 to 60 (56 residues), 74.5 bits, see alignment E=2.8e-25

Best Hits

Swiss-Prot: 100% identical to YJET_SHIFL: Uncharacterized protein YjeT (yjeT) from Shigella flexneri

KEGG orthology group: K09937, hypothetical protein (inferred from 100% identity to eco:b4176)

Predicted SEED Role

"Putative inner membrane protein YjeT (clustered with HflC)" in subsystem Hfl operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AF73 at UniProt or InterPro

Protein Sequence (65 amino acids)

>b4176 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MNSTIWLALALVLVLEGLGPMLYPKAWKKMISAMTNLPDNILRRFGGGLVVAGVVVYYML
RKTIG