Protein Info for b4162 in Escherichia coli BW25113

Name: yjeR
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF00929: RNase_T" amino acids 9 to 170 (162 residues), 141.2 bits, see alignment E=2.3e-45

Best Hits

Swiss-Prot: 100% identical to ORN_ECO24: Oligoribonuclease (orn) from Escherichia coli O139:H28 (strain E24377A / ETEC)

KEGG orthology group: K13288, oligoribonuclease [EC: 3.1.-.-] (inferred from 100% identity to eco:b4162)

MetaCyc: 100% identical to oligoribonuclease (Escherichia coli K-12 substr. MG1655)
Oligonucleotidase. [EC: 3.1.13.3]

Predicted SEED Role

"3'-to-5' oligoribonuclease (orn)" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.- or 3.1.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A784 at UniProt or InterPro

Protein Sequence (181 amino acids)

>b4162 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MSANENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPTIAVHQSDEQLALMDD
WNVRTHTASGLVERVKASTMGDREAELATLEFLKQWVPAGKSPICGNSIGQDRRFLFKYM
PELEAYFHYRYLDVSTLKELARRWKPEILDGFTKQGTHQAMDDIRESVAELAYYREHFIK
L