Protein Info for b4159 in Escherichia coli BW25113

Name: yjeP
Annotation: predicted mechanosensitive channel (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1107 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 476 to 496 (21 residues), see Phobius details amino acids 517 to 539 (23 residues), see Phobius details amino acids 551 to 576 (26 residues), see Phobius details amino acids 598 to 617 (20 residues), see Phobius details amino acids 629 to 649 (21 residues), see Phobius details amino acids 670 to 692 (23 residues), see Phobius details amino acids 698 to 718 (21 residues), see Phobius details amino acids 785 to 808 (24 residues), see Phobius details amino acids 828 to 848 (21 residues), see Phobius details amino acids 871 to 895 (25 residues), see Phobius details amino acids 902 to 929 (28 residues), see Phobius details PF12795: MscS_porin" amino acids 31 to 255 (225 residues), 167.1 bits, see alignment E=1.4e-52 PF12794: MscS_TM" amino acids 478 to 814 (337 residues), 379.5 bits, see alignment E=3.3e-117 PF21088: MS_channel_1st" amino acids 875 to 916 (42 residues), 41.8 bits, see alignment (E = 2.1e-14) PF00924: MS_channel_2nd" amino acids 918 to 983 (66 residues), 88.4 bits, see alignment 6.5e-29 PF21082: MS_channel_3rd" amino acids 991 to 1074 (84 residues), 55 bits, see alignment 2.3e-18

Best Hits

Swiss-Prot: 100% identical to MSCM_ECOLI: Miniconductance mechanosensitive channel MscM (mscM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ect:ECIAI39_4624)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39285 at UniProt or InterPro

Protein Sequence (1107 amino acids)

>b4159 predicted mechanosensitive channel (NCBI) (Escherichia coli BW25113)
MRLIITFLMAWCLSWGAYAATAPDSKQITQELEQAKAAKPAQPEVVEALQSALNALEERK
GSLERIKQYQQVIDNYPKLSATLRAQLNNMRDEPRSVSPGMSTDALNQEILQVSSQLLDK
SRQAQQEQERAREIADSLNQLPQQQTDARRQLNEIERRLGTLTGNTPLNQAQNFALQSDS
ARLKALVDELELAQLSANNRQELARLRSELAEKESQQLDAYLQALRNQLNSQRQLEAERA
LESTELLAENSADLPKDIVAQFKINRELSAALNQQAQRMDLVASQQRQAASQTLQVRQAL
NTLREQSQWLGSSNLLGEALRAQVARLPEMPKPQQLDTEMAQLRVQRLRYEDLLNKQPLL
RQIHQADGQPLTAEQNRILEAQLRTQRELLNSLLQGGDTLLLELTKLKVSNGQLEDALKE
VNEATHRYLFWTSDVRPMTIAWPLEIAQDLRRLISLDTFSQLGKASVMMLTSKETILPLF
GALILVGCSIYSRRYFTRFLERSAAKVGKVTQDHFWLTLRTLFWSILVASPLPVLWMTLG
YGLREAWPYPLAVAIGDGVTATVPLLWVVMICATFARPNGLFIAHFGWPRERVSRGMRYY
LMSIGLIVPLIMALMMFDNLDDREFSGSLGRLCFILICGALAVVTLSLKKAGIPLYLNKE
GSGDNITNHMLWNMMIGAPLVAILASAVGYLATAQALLARLETSVAIWFLLLVVYHVIRR
WMLIQRRRLAFDRAKHRRAEMLAQRARGEEEAHHHSSPEGAIEVDESEVDLDAISAQSLR
LVRSILMLIALLSVIVLWSEIHSAFGFLENISLWDVTSTVQGVESLEPITLGAVLIAILV
FIITTQLVRNLPALLELAILQHLDLTPGTGYAITTITKYLLMLIGGLVGFSMIGIEWSKL
QWLVAALGVGLGFGLQEIFANFISGLIILFEKPIRIGDTVTIRDLTGSVTKINTRATTIS
DWDRKEIIVPNKAFITEQFINWSLSDSVTRVVLTIPAPADANSEEVTEILLTAARRCSLV
IDNPAPEVFLVDLQQGIQIFELRIYAAEMGHRMPLRHEIHQLILAGFHAHGIDMPFPPFQ
MRLESLNGKQTGRTLTSAGKGRQAGSL