Protein Info for b4153 in Escherichia coli BW25113

Name: frdB
Annotation: fumarate reductase (anaerobic), Fe-S subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF13085: Fer2_3" amino acids 8 to 111 (104 residues), 107.6 bits, see alignment E=1e-34 TIGR00384: succinate dehydrogenase and fumarate reductase iron-sulfur protein" amino acids 11 to 229 (219 residues), 328.2 bits, see alignment E=1.1e-102 PF13237: Fer4_10" amino acids 143 to 216 (74 residues), 47 bits, see alignment E=5.8e-16 PF13183: Fer4_8" amino acids 147 to 219 (73 residues), 44.1 bits, see alignment E=7.4e-15 PF13534: Fer4_17" amino acids 149 to 220 (72 residues), 32.4 bits, see alignment E=3.3e-11 PF12838: Fer4_7" amino acids 149 to 218 (70 residues), 30.9 bits, see alignment E=9.5e-11

Best Hits

Swiss-Prot: 100% identical to FRDB_ECOL6: Fumarate reductase iron-sulfur subunit (frdB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00245, fumarate reductase iron-sulfur protein [EC: 1.3.99.1] (inferred from 100% identity to eco:b4153)

MetaCyc: 100% identical to fumarate reductase iron-sulfur protein (Escherichia coli K-12 substr. MG1655)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase iron-sulfur protein (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AC47 at UniProt or InterPro

Protein Sequence (244 amino acids)

>b4153 fumarate reductase (anaerobic), Fe-S subunit (NCBI) (Escherichia coli BW25113)
MAEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRM
AICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPY
IIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRY
NEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIAT
LKPR