Protein Info for b4147 in Escherichia coli BW25113
Name: efp
Annotation: elongation factor P (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to EFP_SHIDS: Elongation factor P (efp) from Shigella dysenteriae serotype 1 (strain Sd197)
KEGG orthology group: K02356, elongation factor P (inferred from 100% identity to eco:b4147)MetaCyc: 100% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0A6N4 at UniProt or InterPro
Protein Sequence (188 amino acids)
>b4147 elongation factor P (NCBI) (Escherichia coli BW25113) MATYYSNDFRAGLKIMLDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTD SAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDNAKWLLDQAECIVTLWNG QPISVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIKVDTRS GEYVSRVK