Protein Info for b4114 in Escherichia coli BW25113

Name: yjdB
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 48 to 71 (24 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details PF08019: EptA_B_N" amino acids 59 to 209 (151 residues), 153.1 bits, see alignment E=5.6e-49 PF00884: Sulfatase" amino acids 238 to 527 (290 residues), 256.3 bits, see alignment E=4.2e-80

Best Hits

Swiss-Prot: 100% identical to EPTA_ECOLI: Phosphoethanolamine transferase EptA (eptA) from Escherichia coli (strain K12)

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 100% identity to eco:b4114)

MetaCyc: 100% identical to phosphoethanolamine transferase EptA (Escherichia coli K-12 substr. MG1655)
RXN-14379 [EC: 2.7.8.43]

Predicted SEED Role

"Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A" in subsystem Lipid A modifications

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P30845 at UniProt or InterPro

Protein Sequence (547 amino acids)

>b4114 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MLKRLLKRPSLNLLAWLLLAAFYISICLNIAFFKQVLQALPLDSLHNVLVFLSMPVVAFS
VINIVLTLSSFLWLNRPLACLFILVGAAAQYFIMTYGIVIDRSMIANIIDTTPAESYALM
TPQMLLTLGFSGVLAALIACWIKIKPATSRLRSVLFRGANILVSVLLILLVAALFYKDYA
SLFRNNKELVKSLSPSNSIVASWSWYSHQRLANLPLVRIGEDAHRNPLMQNEKRKNLTIL
IVGETSRAENFSLNGYPRETNPRLAKDNVVYFPNTASCGTATAVSVPCMFSDMPREHYKE
ELAQHQEGVLDIIQRAGINVLWNDNDGGCKGACDRVPHQNVTALNLPDQCINGECYDEVL
FHGLEEYINNLQGDGVIVLHTIGSHGPTYYNRYPPQFRKFTPTCDTNEIQTCTKEQLVNT
YDNTLVYVDYIVDKAINLLKEHQDKFTTSLVYLSDHGESLGENGIYLHGLPYAIAPDSQK
QVPMLLWLSEDYQKRYQVDQNCLQKQAQTQHYSQDNLFSTLLGLTGVETKYYQAADDILQ
TCRRVSE