Protein Info for b4113 in Escherichia coli BW25113

Name: basR
Annotation: DNA-binding response regulator in two-component regulatory system with BasS (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00072: Response_reg" amino acids 3 to 113 (111 residues), 97.4 bits, see alignment E=5.8e-32 PF00486: Trans_reg_C" amino acids 145 to 216 (72 residues), 75 bits, see alignment E=4.1e-25

Best Hits

Swiss-Prot: 100% identical to BASR_ECOLI: Transcriptional regulatory protein BasR (basR) from Escherichia coli (strain K12)

KEGG orthology group: K07771, two-component system, OmpR family, response regulator BasR (inferred from 100% identity to eco:b4113)

Predicted SEED Role

"Transcriptional regulatory protein basR/pmrA" in subsystem Lipid A modifications or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P30843 at UniProt or InterPro

Protein Sequence (222 amino acids)

>b4113 DNA-binding response regulator in two-component regulatory system with BasS (NCBI) (Escherichia coli BW25113)
MKILIVEDDTLLLQGLILAAQTEGYACDSVTTARMAEQSLEAGHYSLVVLDLGLPDEDGL
HFLARIRQKKYTLPVLILTARDTLTDKIAGLDVGADDYLVKPFALEELHARIRALLRRHN
NQGESELIVGNLTLNMGRRQVWMGGEELILTPKEYALLSRLMLKAGSPVHREILYNDIYN
WDNEPSTNTLEVHIHNLRDKVGKARIRTVRGFGYMLVANEEN